For all your dictionary needs!
Are you looking for Alife, Fife, Kife, lime, lire, lite, Rife, Wife, or Zife?
Header of life

Life

Life appears in the following tongue twister:

  • To sit in solemn silence in a dull, dark dock,
    In a pestilential prison, with a life-long lock,
    Awaiting the sensation of a short, sharp shock,
    From a cheap and chippy chopper on a big black block!
    To sit in solemn silence in a dull, dark dock,
    In a pestilential prison, with a life-long lock,
    Awaiting the sensation of a short, sharp shock,
    From a cheap and chippy chopper on a big black block!
    A dull, dark dock, a life-long lock,
    A short, sharp shock, a big black block!
    To sit in solemn silence in a pestilential prison,
    And awaiting the sensation
    From a cheap and chippy chopper on a big black block!
    (by W.S. Gilbert of Gilbert and Sullivan from The Mikado)

Life appears in the following pangram (a sentence using every letter of the alphabet at least once):

  • The sex life of the woodchuck is a provocative question for most vertebrate zoology majors. (76 letters)
View more pangrams!

Life appears in many palindromes (phrases that read the same backward as forward):

  • Egad, a base life defiles a bad age.
  • Tulsa night life: filth, gin, a slut.
  • If I flee from life, film or feel Fifi.
View more palindromes!

Usage statistics for the noun life:

spoken English32.84%written English67.16% conversational speech32.32%task-oriented speech67.68% imaginative writing52.15%informational writing47.85%
View more statistics!

Life is sometimes a misspelling of leave, left or live.

The word life is considered to be an easy one, according to the Dale-Chall word list, which includes 3000 words that all fourth-grade American students should know and understand.

Video footage: Medium shot of happy male friends meeting and pound hugging each other, then chatting about life
Play/pauseBuy footageFind more

Definition of the noun life

What does life mean as a name of something?

Life is one of the top 50 most common nouns in the English language.View more statistics!

noun - plural: lives

  1. a characteristic state or mode of living
    • examples: social life | city life | real life
    • lexical domain: States - nouns denoting stable states of affairs
    • more generic terms: being / beingness / existence / face of the earth = the state or fact of existing
    • more specific word: ghetto = any segregated mode of living or working that results from bias or stereotyping
  2. the experience of being alive; the course of human events and activities
    • example: he could no longer cope with the complexities of life
    • lexical domain: Cognitive Processes - nouns denoting cognitive processes and contents
    • synonym of life: living
    • more generic word: experience = the content of direct observation or participation in an event
  3. the course of existence of an individual; the actions and events that occur in living
    • examples: he hoped for a new life in Australia | he wanted to live his own life without interference from others | get a life! | he is trying to rebuild his life
    • lexical domain: States - nouns denoting stable states of affairs
    • more generic terms: being / beingness / existence / face of the earth = the state or fact of existing
  4. the condition of living or the state of being alive
  5. the period during which something is functional (as between birth and death)
    • examples: the battery had a short life | he lived a long and happy life
    • lexical domain: Time - nouns denoting time and temporal relations
    • synonyms of life: life-time / lifespan / lifetime
    • more generic terms: period / period of time / time period = an amount of time
    • more specific words: afterlife / hereafter = life after death
    • parts:
      • birth = the time when something begins
      • demise / death / dying = the time when something ends
      • time of life = a period of time during which a person is normally in a particular life state
      • age / eld = a time of life (usually defined in years) at which some particular qualification or power arises
  6. the period between birth and the present time
    • example: I have known him all his life
    • lexical domain: Time - nouns denoting time and temporal relations
    • more generic terms: period / period of time / time period = an amount of time
    • part: past = a earlier period in someone's life
  7. the period from the present until death
    • example: he appointed himself emperor for life
    • lexical domain: Time - nouns denoting time and temporal relations
    • more generic terms: period / period of time / time period = an amount of time
    • more specific words: years / days = the time during which someone's life continues
  8. a living person
  9. animation and energy in action or expression
  10. living things collectively
    • example: the oceans are teeming with life
    • lexical domain: Tops - unique beginner for nouns
    • more generic terms: animate thing / living thing = a living (or once living) entity
    • more specific word: wildlife = all living things (except people) that are undomesticated
  11. the organic phenomenon that distinguishes living organisms from nonliving ones
    • example: there is no life on the moon
    • lexical domain: Natural Phenomena - nouns denoting natural phenomena
    • more generic term: organic phenomenon = a natural phenomenon involving living plants and animals
    • more specific words:
      • biology = characteristic life processes and phenomena of living organisms
      • aerobiosis = life sustained in the presence of air or oxygen
  12. an account of the series of events making up a person's life
  13. a motive for living
    • example: pottery was his life
    • lexical domain: Motives - nouns denoting goals
    • more generic words: motivation / motive / need = the psychological feature that arouses an organism to action toward a desired goal; the reason for the action
  14. a prison term lasting as long as the prisoner lives
    • example: he got life for killing the guard
    • lexical domain: Time - nouns denoting time and temporal relations
    • synonym of life: life sentence
    • more generic terms: prison term / sentence / time = the period of time a prisoner is imprisoned

Films

  1. Life was an American crime drama television program created by Rand Ravich that aired for two seasons on NBC. It was produced by Universal Media Studios under the supervision of executive producers Rand Ravich, Far Shariat, David Semel, and Daniel Sackheim. Semel also directed the pilot.
    • also known as 重獲新生, 刑警重生
    • begun on and completed on (5 years ago)
    • 32 episodes of 60 minutes each, in 2 seasons
    • country: United States of America
    • created by Rand Ravich
    • regular cast:
      • Sarah Shahi as Dani Reese between and (1 year and 6 months)
      • Damian Lewis as Charlie Crews between and (1 year and 6 months)
      • Adam Arkin as Ted Earley between and (1 year and 6 months)
      • Donal Logue as Kevin Tidwell between and (6 months)
      • Brent Sexton as Bobby Stark between and (1 year and 6 months)
      • Brooke Langton as Constance Griffiths between and (2 months)
      • Robin Weigert as Karen Davis between and (2 months)
    • genres: Police procedural, Drama
    • some of the awards:
        • People's Choice Award for Favorite New TV Drama
        • Primetime Emmy Award for Outstanding Achievement in Non-Fiction Programming - Picture Editing (Challenges Of Life, Outstanding Picture Editing for Nonfiction Programming) nomination for Sharon Gillooly & Martin Elsbury
  2. "Life" is a 1999 American comedy-drama film written by Robert Ramsey & Matthew Stone and directed by Ted Demme. The film stars Eddie Murphy and Martin Lawrence. The supporting cast includes Obba Babatundé, Bernie Mac, Anthony Anderson, Miguel A. Núñez Jr., Bokeem Woodbine, Guy Torry and Barry Shabaka Henley. The film's format is a story being told by an elderly inmate about two of his friends, who are both wrongly convicted of murder and given a life sentence in prison. The film was the last R rated role to date for Eddie Murphy who has stuck mainly to family friendly films for the past 15 years of his career.
  3. "Life" is a film, directed by Anton Corbijn.
  4. "Life" a.k.a. "Vazhkai" is a 1949 Black-and-white social guidance film film produced and directed by A.V. Meiyappan with his company AVM Productions. The film starred Vyjayanthimala in her screen debut with M. S. Draupadi, T. R. Ramachandran and S. V. Sahasranamam forms an ensemble cast along with many actors appearing in other significant role.
  5. "Life" a.k.a. "Zindagi" is a 1940 Indian Bollywood film directed by P.C. Barua. It was the highest grossing Indian film of 1940. The music, by Pankaj Mullick, features songs such as 'So ja Rajkumari' and 'Jeevan asha hai'. The film has been described as one of Barua's most beautiful films, and his last for New Theatres". The film revolves around Ratan, an unemployed university graduate.
  6. "Life" a.k.a. "One Life" is a 2011 documentary film written and directed by Michael Gunton and Martha Holmes.
  7. "Life" is a 1984 film written by Yao Lu and directed by Tian-Ming Wu.
    • also known as Ren Sheng
    • country: China
    • director: Wu Tianming
    • starring:
    • released in (31 years ago)
    • award:
      • Hundred Flowers Award for Best Picture
      • Hundred Flowers Award for Best Actress nomination for Yufang Wu
      • Golden Rooster Award for Best Music nomination for Youfu Xu
      • Hundred Flowers Award for Best Actor nomination for Zhou Lijing
      • Hundred Flowers Award for Best Supporting Actor nomination for Baocheng Gao
      • Hundred Flowers Award for Best Supporting Actress nomination for Xiaoli Li
      • Hundred Flowers Award for Best Picture
      • Hundred Flowers Award for Best Actress, received by Yufang Wu
      • Golden Rooster Award for Best Music, received by Youfu Xu
  8. "Life" is a 2013 short comedy family film written and directed by Lasse Lorenzen.
  9. "Life": Kiank is a 1993 short documentary film written and directed by Artavazd Peleshian.
  10. "Life" is a 1928 British silent drama film directed by Adelqui Migliar and starring Migliar, Marie Ault and Marcel Vibert. It was based on the 1895 play Juan José by Joaquín Dicenta. The film was made by Whitehall Films. While the company's new studio was constructed at Elstree, the film was shot on location in Spain.
    • country: United Kingdom
    • language: English Language
    • genre: Drama
    • released in (87 years ago)
  11. "Life" is a 1996 drama film written by John Brumpton and Lawrence Johnston and directed by Lawrence Johnston.
  12. "Life" is a 2011 drama film written and directed by Rick Jacquet.
    • starring: Sasha Grey as Sarah
    • released on
  13. Life: Adapted from Keiko Suenobu's manga "LIFE," this drama delves into the dark side of high school life. The story focuses mainly on bullying, but the manga also touches on subjects such as self-mutilation, suicide, and rape. Kitano Kii stars as Ayumu Shiiba, one of the students bullied by a group of classmates led by Ayumu's former friend, Manami Anzai.
  14. "Life" is a film, directed by Lee Gang-Cheon.
  15. "Life" is a short film, directed by Cho Eun-Ryung.

Writings

  1. "Life" is the book written by Keith Richards.
  2. "Life" is a book by David Sadava.
    • subjects: Science, Biology

Music

  1. "Life" is the second studio album by nu metal band Dope. It was released on November 6, 2001 on Epic Records, and has sold over 73,000 copies in the U.S.
  2. "Life" is the third single by the Japanese artist Yui. It was released November 9, 2005, under Sony Records. "Life" has been the 5th ending theme for the popular anime series Bleach.
    • also known as LIFE 〜YUI Acoustic Version〜
    • music and lyrics by YUI
  3. "Life" is the eighth album by Ricky Martin. It was released on October 10, 2005 in Europe, October 11, 2005 in the US and October 19, 2005 in Japan.
  4. "Life" is the fifth studio album by British band Simply Red, released in 1995. The lead single "Fairground" became their first number 1 hit in the UK. Due to this success, the album also made #1 on the UK album chart. It also included "We're in This Together", the official theme song for Euro '96. This was also the last album to feature band member Fritz McIntyre.
  5. "Life" is a popular song recorded by the British pop and soul singer Des'ree. It was the third single from her third album, Supernatural, and was released on 2 June 1998. This song remains Des'ree's biggest hit, peaking at number one in Austria, Italy, the Netherlands and Spain.
  6. "Life" is the second studio album of The Cardigans. It was released worldwide in 1995 and was an international success, especially in Japan, where it achieved platinum status. Outside of Sweden and Japan, the album was released as their first album as a compilation of tracks from both Emmerdale and Life. It was released in the United States under the label Minty Fresh Records.
  7. "Life" is a double live album by Irish band Thin Lizzy, released in 1983. This double album was recorded during their farewell tour in 1983, principally at the Hammersmith Odeon in London, UK. Phil Lynott had felt reluctantly that it was time to disband the group after the 1983 tour and to mark the occasion, former Thin Lizzy guitarists Eric Bell, Brian Robertson and Gary Moore joined the band on stage at the end of these gigs to do some numbers. This was called "The All-Star Jam".
  8. "Life" is the sixteenth studio album by Canadian musician Neil Young, his fifth with Crazy Horse, and Young's last release on the Geffen label.
  9. "Life" is the sixth solo album by Houston rapper Z-Ro. The track "Lost Another Soldier" is dedicated to late fellow rapper Big Mello. On June 15, 2010, the album was reissued in a collector's edition 3 disc box set, including the regular, and chopped and screwed versions of the album, and bonus DVD about the making of the album, and the story behind KMJ Records.
  10. "Life" is a song recorded by the Trinidadian-German musician Haddaway. It was released in November 1993 as the second single from his debut album Haddaway. Another CD maxi were produced at the end of that year containing new remixes.
    • also known as Everybody Needs Somebody to Love, Life (album remix), Life (Everybody Needs Somebody to Love)
    • music by Dee Dee Halligan
    • lyrics by Junior Torello
  11. "Life" is the debut studio album by the British indie rock band Inspiral Carpets. It was released on 23 April 1990 on Cow Records, through Mute Records, during the period dubbed Madchester by the British media. The group released three singles from this album: "Move", "This Is How It Feels" and "She Comes In The Fall", with the latter two in different versions from those found on the album.
  12. "Life" is the third independent album by rapper Yo Gotti. It was released on May 13, 2003 through TVT Records.
  13. "Life" is the third studio album by funk/soul band Sly and the Family Stone, released in September 1968 on Epic/CBS Records.
  14. "Life" is an album by War, released on RCA Victor Records in 1983. It marked the end of a continuous string of albums by the group from 1970, and they would not record another album until a decade later. The band's lineup is not stated on the cover, but composer credits suggest they had been reduced from eight members to five.
  15. "Life" was the 4th studio album by hard rock band Talisman released on 23 August 1995 on Polydor Records.
    • genre: Hard rock
    • released in (20 years ago)
  16. "Life" is a song recorded by the Swedish musician known under the pseudonym of E-Type featuring Na Na. It was released in October 2001 as the second single from his third album Euro IV Ever and was a hit in several countries, particularly in Sweden and Norway where it reached the top 5.
  17. "Life" is Heo Young-saeng's third Korean EP. It was released on March 13, 2013 by B2M Entertainment and distributed by CJ E&M. The album was created with the help of Sweetune.
    • genre: K-pop
    • released on
  18. "Life" was the Macedonia's entry in the Eurovision Song Contest 2004, performed in English by Toše Proeski. A full Macedonian language version was recorded as "Angel si ti" and in the Macedonian national finals, all Proeski's songs were performed in Macedonian.
  19. "Life" is Cueshe's fourth and current album released on September 1, 2010 by Sony BMG Philippines.
  20. "Life", released in 2001, is the second album by the American Christian pop rock band ZOEgirl. "With All of My Heart", "Here and Now", "Even If", "Dismissed" and "Plain" were released as singles.
    • released on (13 years ago)
  21. "LIFE" is the fourth full studio album by Angela Aki released on September 8, 2010.
    • genre: J-pop
    • released on (4 years ago)
  22. "Life" is a 1971 song by Elvis Presley. It was written by Shirl Milete. Elvis recorded it June 6, 1970. The single release had a seven-week stay on Billboard's Hot 100 chart, peaking at #53. It reached #8 on the Easy Listening chart and #34 on the Country Chart. It was the A-side to Only Believe. It was originally released on Elvis' "Love Letters from Elvis" album.
  23. "Life" is a musical album of Marcia Hines.
    • released in (8 years ago)
  24. "LIFE" is a composition.
  25. "Life" is Mika Nakashima's 23rd single, released on August 22, 2007. Within the first press it included a picture label. The song "Life" is best described as an adult contemporary pop/rock song, and was used as the theme song for the drama of the same name, starring Kii Kitano and Saki Fukuda; the B-side "It's Too Late" was used for Kanebo Kate CM, which starred Nakashima herself.
  26. "Life" is the fourteenth album released by KRS-One, and the eight after abandoning the Boogie Down Productions name. The album is a collaboration with Tunnel Rats affiliates The Resistance, a little known production team, and Footsoldiers.
  27. "Life", released in 2005, is the second full-length album by British DJ and electronic dance music composer Andy Hunter°. It may actually be considered an EP as it features only six songs, but each song's duration of +6 minutes makes up for a total playing time of 43:45.
  28. "Life" is a song by Canadian rock group Our Lady Peace. It was the second single released from their fourth studio album, Spiritual Machines and the most successful from that album. The song was nominated for "Best Single" at the 2002 Juno Awards, losing to Nickelback's "How You Remind Me".
  29. "Life" is a pop rock song written by Ana Johnsson, Jörgen Elofsson, Mathias Venge, and Pontus Wennerberg and recorded by the pop rock singer Ana Johnsson. It was released as the second single the Swedish released from her first studio album Cuz I Can, which was only released in Sweden.
  30. "Life" is a song by American R&B duo K-Ci & JoJo. It was the first single off their second studio album It's Real. It is also featured on the soundtrack for the 1999 movie Life. The lyrics were written by the said duo and R&B singer R. Kelly.
  31. "Life" is the debut solo album by American rapper and former Stetsasonic and Gravediggaz member Frukwan, released on the BMG label in 2003.
  32. "Life" is a musical single of Haddaway.
    • also known as Life (Everybody Needs Somebody To Love)
    • released on (21 years ago)
  33. "Life" is a cataloged instance, composition.
  34. "Life" is a 1998 single album by Des'ree.
    • artist: Des'ree
    • released on (17 years ago)
    • award: - Brit Award for British Single nomination for Des'ree

Person

Who is Life?

Life MC is part of the trio, Phi Life Cypher, a Luton-based British Hip Hop group. He has also released five solo albums to date as well as various mixtapes with DJ Nappa. He is renowned for his freestyling capabilities, much of this can be watched on the internet site YouTube, alongside several music videos filmed in and around Luton.

Group

Life is a musical group.

  • album: "Life"

Food

Life is a breakfast cereal formerly made of whole grain oats, but now also containing corn flour, whole wheat flour, and rice flour. It is distributed by the Quaker Oats Company. It was introduced in 1961.

  • also known as Cereals ready-to-eat, QUAKER, QUAKER OAT LIFE, plain

There are other foods with Life in their name, like Quaker Life Cereal Cinnamon, Quaker Oat Life Plain Cereal and Quaker Life Cereal Honey Graham.

Miscellanea

  1. Life is a characteristic distinguishing physical entities having signaling and self-sustaining processes from those that do not, either because such functions have ceased, or because they lack such functions and are classified as inanimate. Biology is a science concerned with the study of life.
  2. Life is a British nature documentary series created and produced by the BBC in association with The Open University, it was first broadcast as part of the BBC's Darwin Season on BBC One and BBC HD from October to December 2009. The series takes a global view of the specialised strategies and extreme behaviour that living things have developed in order to survive; what Charles Darwin termed "the struggle for existence". Four years in the making, the series was shot entirely in high definition.
    • also known as Life (UK)
    • begun on and completed on (5 years ago)
    • 10 episodes of 30 or 50 or 60 minutes each
    • country: United Kingdom
    • regular cast: David Attenborough
    • genres: Documentary film, Nature, Children's television series
    • award:
      • Primetime Emmy Award for Outstanding Non-fiction Series nomination for Catherine McCarthy, Mike Gunton, Susan Winslow, Martha Holmes, Paul Spillenger
      • Primetime Emmy Award for Outstanding Cinematography For Nonfiction Programming (Challenges Of Life)
      • Primetime Emmy Award for Outstanding Writing - Nonfiction Programming (Challenges Of Life) nomination for Paul Spillenger
      • Primetime Emmy Award for Outstanding Achievement in Non-Fiction Programming - Sound Editing (Outstanding Sound Editing for Nonfiction Programming (Single or Multi-Camera) Episode: Challenges Of Life) nomination for Kate Hopkins
      • Primetime Emmy Award for Outstanding Achievement in Non-Fiction Programming - Sound Mixing (Challenges Of Life, Outstanding Sound Mixing for Nonfiction Programming) nomination for John Rigatuso & Graham Wild
      • TCA Award for Outstanding Achievement in Movies, Miniseries and Specials
      • TCA Award for Outstanding Achievement in News and Information
      • British Academy Television Craft Award for Editing - Factual (Birds) nomination for Jo Payne
      • British Academy Television Craft Award for Sound - Factual (Insects) nomination for Chris Domaille, Graham Wild, Tim Owens & Kate Hopkins
      • British Academy Television Craft Award for Photography - Factual (Insects) nomination for Kevin Flay & Rodney Clarke
      • Primetime Emmy Award for Outstanding Cinematography For Nonfiction Programming (Challenges Of Life)
      • TCA Award for Outstanding Achievement in News and Information
    • official website: www.bbc.co.uk/programmes/b00njcq2
  3. Life is a shōjo manga series created by Keiko Suenobu, a manga creator well known for her work on Vitamin and Happy Tomorrow. Life was serialized in Bessatsu Friend, a publication of Kodansha, and deals with many controversial topics such as self-mutilation, bullying, rape, suicide, and manipulation. In 2006, it won the Kodansha Manga Award for shōjo.
    • also known as ライフ, Raifu
  4. LIFE is a UK-based "pro-life and educational" charity. It was founded in 1970 by Professor Jack Scarisbrick and his wife Nuala in response to the Abortion Act 1967, which greatly extended access to legal abortion in the United Kingdom.
  5. Life is a peer-reviewed open access scientific journal published by MDPI. It was established in 2011. The editor-in-chief is Pabulo Henrique Rampelotto.
  6. Life are a US alternative rock/pop band from Hermosa Beach, California, made up of the founding members of Tomorrows Bad Seeds, Moises Juarez, Sean Chapman and Matthew "Mets" McEwan. Moi, Sean and Mets were friends from school and grew up together in Hermosa Beach.
  7. Life, by David E. Sadava et al, is a biological science textbook used at many colleges and universities around the United States of America.
  8. Life is a Canadian experimental film directed by Mark Penney.
    • country: Canada
    • languages: Portuguese Language, English Language, French, Korean Language

Phrases with Life

Phrases starting with the word Life:

  1. Life Cot
  2. life belt
  3. life buoy
  4. life form
  5. life line
  6. life mask
  7. life peer
  8. life raft
  9. life ring
  10. life vest

Phrases ending with the word Life:

  1. No-Life
  2. To Life
  3. Get Life
  4. Pot Life
  5. pro-life
  6. Sex life
  7. Sex-life
  8. half life
  9. half-life
  10. high life

View more phrases with the word Life in thesaurus!

Printed dictionaries and other books with definitions for Life

Click on a title to look inside that book (if available):

Google previewLIFE IS AN INVESTMENT (2014)

by VICTOR NWAORGU

Our life is the sincere product of the influence of the Holy Spirit we cannot make the necessary impact in the world for Christ without him, the Holy Spirit can give us the power to become all that we desire. We do not need to be perfect to be ...

Google previewThe World of the Civil War: A Daily Life Encyclopedia [2 volumes] (2015)

A Daily Life Encyclopedia by Lisa Tendrich Frank

Due to the intentional separation of nuclear families and the harshness of enslaved life, enslaved persons formed tight bonds with each other. The impact of the Civil War was greatly felt on the farms and plantations of the rural South.

Google previewSelf Help Book: The Dictionary Of Life (2013)

Relationship Books - A Personal Development Guide to Happiness by I.B Opene

Author: You see; life isalways about growth and evolution. Divorce and breakupsarea natural consequence of resisting personal as well as societal evolution. This is no contradiction. It should come as no surprise either to Mankind having ...

Online dictionaries and encyclopedias with entries for Life

Click on a label to prioritize search results according to that topic:

Usage statistics about life

The following statistics are based on the British National Corpus, so they are representative for the British English from the later part of the 20th century, both spoken and written.

Usage statistics for the noun life:

spoken English32.84%written English67.16% conversational speech32.32%task-oriented speech67.68% imaginative writing52.15%informational writing47.85%

Distribution of usage frequency for the most common synonyms of the noun life:

life-timeanimationbiographylifetimelifespanlivingspiritlife

Photos about Life

Click on an item to view that photo:

life

View more pictures about Only Life.

If you need related images for an article or a report, you can download stock photos:
Small photo of Still life with dahlias in a copper vase (textured for artistic effect)Small photo of Still life of mushroomSmall photo of Still life of mushroomSmall photo of Still life of mushroomSmall photo of life belt, rescue ring on wooden wallSmall photo of Life Insurance Health Protection ConceptSmall photo of Business woman working on the laptop computer sitting near the relaxing sport woman in city park, Life balance concept, Workaholic and healthy lifestyle. More...

Video language resources about Life

Click on an item to play that video:

View more videos about Hi Life, To Life, New Life, Second Life, and Waking Life.

See also the pronunciation examples of Life!

Sign language

Click on an item to play that video:

Quotes about Life

Life is unfair
Life is unjust
Life is nieve
Life is cruel in everyway
Life is hard it cant be easy.

Life can be good
Life can be fun
Life can be exciting
Life can be everything.
Life can be hard it cant be easy. (Stephen Townsend)
more quotes about life...

Scrabble value of L1I1F4E1

The value of this 4-letter word is 7 points. It is included in the first and second editions of the Official Scrabble Players Dictionary.

Anagrams of LIFE

What do you get if you rearrange the letters?

See also the blanagrams of Life!

Share this page

Next...

Go to the usage examples of Life to see it in context!


Privacy Policy | Cookies Policy
Keyword Tool | Romanian-English Dictionary